DPCstruct | MC33789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 137 ± 28 aa |
| Standard deviation of domain lengths | 28.13 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 92.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0UN00 | 116-266 | MTNTPSMLREMARQIQALGVRPEIEVFDTGHLVFAKQLVAEGLVEEPPLLQLCLGIPYGAPDDPGTLLALVNQLPPGCIFSAFAIGR… |
| X1F0N7 | 15-138 | VGMIVTCLRMRERGFFDDPLHFQFVLGTPWGSPGTPRSLFHMCEMIPEDATWSVIGVGRAHLPMSMMALCMGGHIRVGMEDNIYYRR… |
| A0A399ES26 | 104-231 | None |
| A0A7S3ZLI7 | 21-145 | None |
| A0A4U5JAD6 | 15-112 | None |
| A0A645JIC0 | 3-137 | None |
| A0A1B1ZR61 | 68-220 | None |
| A0A7K0PIC3 | 1-113 | None |
| A0A194X9X4 | 279-497 | None |
| A0A7R7BFL2 | 499-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.