DPCstruct | MC33785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 128 ± 27 aa |
| Standard deviation of domain lengths | 27.12 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 53.33 |
| Assigned Pfam label(s) | CL0492- PF14940- CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7L7K7 | 103-213 | RDMLDVRSVPVTLSLTDLADLALPPPRIREVSSVEASLRLDSILSAGLRLSRSKAADLVRQGSVRVNWRPVAKPSVELSAGDIISCS… |
| A0A845EIT1 | 2-88 | NWLEQDKTVSSLRLDTVIKEIYNLSRKDAALFISKQQVKVNFKIEEDAKYRLQSGDMLSIRGKGRSKVVSINGSTKKDKLKITVALL |
| A0A7S3UEU9 | 139-296 | None |
| A0A7J6YSR9 | 73-166 | None |
| A0A3D0II48 | 3-98 | None |
| A0A7R9TXX1 | 50-226 | None |
| A0A2T7P783 | 18-133 | None |
| A0A0R2K9J8 | 66-200 | None |
| A0A182JKX1 | 1-117 | None |
| A0A7N0RFI3 | 169-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.