DPCstruct | MC33781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255PCW3 | 3-93 | ALARVVCTCPSVPAQWDAWTVDGQYLYLRYRSGRGTVDAYDSHDSETWDVVPDGHFAEFCDPNDPWRGEIELDEFLRRAGLRLATLA… |
| A0A1U9ZZM7 | 3-92 | TTLVKVIQTVRDCDLSQWDAWTADGQYLCLRYQSGLGTVDAYDTADWRTWSHPPYGSVAEFGEPGPDGAISLEDFCAAAGLLLAPGA… |
| A0A4D4MED2 | 64-161 | None |
| A0A7Z0EJR2 | 1-76 | None |
| A0A2L0NFT5 | 1-94 | None |
| A0A4P6Q068 | 1-81 | None |
| A0A4R7IAD5 | 91-182 | None |
| A0A249M6D4 | 131-224 | None |
| A0A561T761 | 156-246 | None |
| A0A561V2W0 | 31-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.