DPCstruct | MC3378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 128 ± 22 aa |
| Standard deviation of domain lengths | 22.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W6CZ29 | 1-105 | MTYASLEDLVERAGMDEIVQVADRDGDLIPDPEVIGAALVHADNIVDGYLAGRYQLPFPQVPDLVRTWATAIARYQLHRWDPPDYVV… |
| A0A1Y1J2T2 | 1-156 | MSYATVADMVARFGALELIQLTDVDNIPPSTIDEARVGLKLEDASSFIDGYVGQVYRLPLQGCRKPPIPGQPVEYAMPPVLVRMACD… |
| A0A847DM14 | 6-151 | None |
| A0A7Y0THZ2 | 1-138 | None |
| A0A377INR7 | 18-110 | None |
| A0A2A2ARL1 | 1-173 | None |
| A0A7L5XUC0 | 123-245 | None |
| A0A0T9RRT2 | 2-86 | None |
| A0A2G2I3V7 | 19-133 | None |
| A0A545SC08 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.