DPCstruct | MC33778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 24.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 84.72 |
| Assigned Pfam label(s) | PF06996- PF05947- CL0763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2YF07 | 9-165 | AAALTTLSQHIREYSVYQAIPLILGVLREVHPDADDEQLHAFLELRANPSLGFPCSDIERLDFFHEHTDLYVRLYLNVMSLVGSGSP… |
| A0A2X3ENQ5 | 11-150 | MNFYRFCQLLEKNHPKAPLIGSGWLVGDEPIRFRPHPGMGFPAGEIRGMDDPEPPRPPAVRVTFMGLYGVESPLPTHYSDDIAQRRE… |
| A0A1H4BHJ2 | 154-348 | None |
| A0A812R4E3 | 279-453 | None |
| A0A399I9Y7 | 1-163 | None |
| A0A5M0YLB4 | 7-133 | None |
| A0A484YXW9 | 112-259 | None |
| A0A4V1XRP7 | 770-943 | None |
| A0A377LXW1 | 12-146 | None |
| G1Y226 | 597-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.