DPCstruct | MC33776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3EKI2 | 7-95 | KKNQASFDLRHFVELNFTLPKENDTYVPPKGQTLRQHIDGLWPVLTRSTVEVEKWDSLLPLPKPYVVPGGRFREVYYWGQLFHDAGS… |
| A0A074TW93 | 65-165 | SDPLTILADYRMQHTQSGFDLRHFVEMNFILPKEGEKYVPPEGQSLREHIDDLWPVLTRTTDKANKWDSLLPLPKPYVVPGGRFREV… |
| A0A377K7K2 | 3-90 | None |
| A0A3S4JRV7 | 1-108 | None |
| A0A6D0EKT0 | 14-115 | None |
| A0A7U2Q4E6 | 76-177 | None |
| A0A2X1KRE5 | 1-102 | None |
| A0A2X2XTU2 | 2-97 | None |
| X1WRT6 | 52-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.