DPCstruct | MC33774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379AFL9 | 1-76 | MGIQGTHTARFGEIEQRGVALTPQGRALYDRLLSEAGSGQDNQQHQQHLAAIFRDFPDDETTLRQQELAWFPLSPE |
| A0A455UZT6 | 102-177 | GHHTARFGEIEQRGVALTQKGRALYDQLLAQSRQLPAAQDNATHQAHLAEVFQAFPDDLDTLRREGLAFFHYYAAP |
| A0A2G1C481 | 1-69 | None |
| A0A4Q3QAT3 | 179-255 | None |
| A0A748M7W2 | 213-298 | None |
| A0A376THA2 | 98-183 | None |
| A0A376KUK1 | 187-266 | None |
| A0A7G2IU32 | 99-169 | None |
| A0A455UGJ0 | 15-97 | None |
| U3TVC6 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.