DPCstruct | MC3376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 268 ± 25 aa |
| Standard deviation of domain lengths | 25.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109C645 | 137-378 | VPNNRYLAIMDTSNRCWVKTADEAVTGESAGTGEANYSVSLVSAPVDEGTLKVHYTIGGNTYMAVDDGSGAVTGVNITSGSINYNTG… |
| A0A1Y1J1F3 | 1-263 | MVGHTGSITATFSNDQTVDCGRVRLSRVRLVGADGKVIHGGYTANLEAGLVHIVDVAAWAQPVTIEHRIEDMAVVRDVQISGEISFA… |
| A0A2G6PDU6 | 64-363 | None |
| A0A1H0N1G9 | 171-460 | None |
| A0A2G6ZNS1 | 636-925 | None |
| A0A839HDT6 | 346-639 | None |
| A0A845TLM7 | 244-529 | None |
| A0A2N0WWU0 | 832-1054 | None |
| A0A1F4E6V8 | 959-1195 | None |
| A0A7X7H5K8 | 724-989 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.