DPCstruct | MC33759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 222 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A411YEK9 | 375-582 | GYAVELEPSGQVWLVPQDSAIERVAAMSYRRWHVEDLAPGDQVIVARGTGREDLFTRLVEEKHRDHDVQDLKVVIERWRRACRAVVA… |
| A0A1I2YT04 | 428-642 | VVAVGTFTNGERILFSKYYKAFVFDKSKGTVTETDVEELESGDMLVFTRRDDFTRNMVDNVFDNLLSSGLLNESVKEAAFKSAYWKL… |
| A0A7J2R8B0 | 307-520 | None |
| A0A1C4S613 | 226-432 | None |
| A0A7Y5AZS7 | 295-505 | None |
| A0A068NW27 | 662-884 | None |
| A0A7X5W5L0 | 570-795 | None |
| A0A151AAB0 | 1016-1252 | None |
| A0A180FU36 | 195-453 | None |
| A0A0W8FFR3 | 529-751 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.