DPCstruct | MC33758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384D8L2 | 90-174 | PSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLFEKNLVKHLNQGTDEDIYLLGKATLPGFRKIR |
| V8NRD5 | 5-88 | APYHASIVLMMHFCDEVNVYEFLPSKRQTSLCHYYEDTFDQACTLGAYHPLLFEKNMVKHLSQGTDEDIYDYGKVTLPGLRKTQ |
| A0A553P0P3 | 427-504 | None |
| A0A4C1U523 | 216-295 | None |
| A0A4Z2E5X6 | 13-96 | None |
| B7PMT9 | 69-151 | None |
| A0A498M8P2 | 217-301 | None |
| A0A060C7Y7 | 2-74 | None |
| A0A6G0HH66 | 329-418 | None |
| A0A670I7T2 | 546-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.