DPCstruct | MC33757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF08977- PF08955 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4UQA1 | 59-216 | TENTDDNTVKTENVDNTEDHLQMVIADNTITESTKMVYQYYYKNEGVMEESEEVPPYFLLGFDFNDMLEYYPDWQIVSFSSKEVVMR… |
| A0A4R6MWF0 | 90-219 | REVHMITTFICGTETTEMGQLKAGSIAELLEQHPDWHARLNTKGELWVDRQVEDLSPLCKKQAYMGMNREGQLTLFEGPPKKDKVIR… |
| A0A645G8Y0 | 5-148 | None |
| A0A3B9SPI4 | 7-160 | None |
| A0A0M0L7I3 | 1-143 | None |
| A0A7X8FBQ9 | 36-213 | None |
| A0A229P057 | 43-200 | None |
| A0A3E0QQU2 | 176-340 | None |
| A0A2K8N7X1 | 1-180 | None |
| W7Z7Y6 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.