DPCstruct | MC33752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 115 ± 27 aa |
| Standard deviation of domain lengths | 27.37 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3FF59 | 1-73 | MKEVIGSHRTYYKLRVCQEAIWEAFRIFFDRVPDSEEYRSWVYTCQHENLCMDDLAKNFSSAQEHLDMVARVS |
| A0A3B4U9Z6 | 1-126 | MSTRTKGSGFELGRRRSRRSVFLHSGVRICPQETINEVLASHQAYYQLRVCQEAVWEAFRIFFDRIPGTAEYQRWVHTCQHESLCIV… |
| A0A3Q1EQB7 | 9-140 | None |
| A0A6I9MVN0 | 35-158 | None |
| A0A803Y8F2 | 1-83 | None |
| A0A4Z2BPT0 | 26-163 | None |
| S9X6S9 | 1-119 | None |
| A0A6F9CFL1 | 27-171 | None |
| A0A672GW34 | 4-80 | None |
| A0A3Q4HC60 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.