DPCstruct | MC3375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1U6S5 | 4-79 | LDMSVFDAVEVHGCTVVDDYDGREIIEQTADGVPDFWSVYLHYKSGGLDCIADFRDEHQAKLFADQMARQHGLMRY |
| U4DZM1 | 14-95 | SLDWSLYDALELSGVYVYEIDGETYCERADCESDVQMYSLYAHLKSGGCDCIHDFPRGGSLKDALEKSEGLAKTQALELYDF |
| A0A4Q5VAM4 | 161-246 | None |
| A0A6P1IN12 | 12-100 | None |
| A0A7W6QU35 | 111-204 | None |
| A0A7Y8UJD5 | 64-150 | None |
| A0A1R1VM24 | 17-101 | None |
| V9ZZN3 | 1-91 | None |
| A0A5Q3HEI3 | 100-183 | None |
| X5R1X0 | 10-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.