DPCstruct | MC33747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 440 ± 101 aa |
| Standard deviation of domain lengths | 101.40 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1LQ98 | 1-346 | MKWPWVHEVREAAEDIYSKIRGGAVTPFHIVDWIFGLTLPGEWMSLKIMSSMVLLTESVKNQGVAAFYDCGFVTPQRSYHRIRNVLG… |
| N1RD20 | 3-490 | LSRPDWIDFSNPRNQVATRFIFDRSPGNEEQFHKFFHQLLLSLELELRIQSDQHSDWAKEKLTSQIPPSIQWNLALARRWQDFVRVD… |
| A0A0U5GRS4 | 531-876 | None |
| A0A4T0VX07 | 375-945 | None |
| A0A0D2IQG3 | 531-851 | None |
| A0A0M8N968 | 222-688 | None |
| A0A2B7WMY7 | 397-756 | None |
| A0A3N4IDL1 | 462-1072 | None |
| G4TH71 | 348-888 | None |
| A0A1X2G9X3 | 265-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.