DPCstruct | MC33744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6S9E4 | 1-98 | MPDVHTLVNDFIIKLKSGIKIEGSQATAKQTAELLRSVISSQRVPYTNQAGALIDAVKAVGEQLIAANVEHAVGNIVRRVLHIIREE… |
| A0A1B7P4A7 | 21-138 | TSDVDSATENLISLLKRRQIRPSHSCAVATAYLLLRVVSTSKITDPAKLIDRVQNVGRRVIAAQPREMVVGNIVRRVLGLIREEAED… |
| A0A452Y9K0 | 1-114 | None |
| A0A4S9BY24 | 5-149 | None |
| A0A5P1F9P5 | 1-119 | None |
| A0A7S3V0P0 | 11-144 | None |
| A0A2Z6RCY0 | 3-116 | None |
| L7IVL5 | 602-748 | None |
| A0A0G4MVV5 | 1-127 | None |
| A0A317SE63 | 10-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.