DPCstruct | MC33743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 165 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 25.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7P144 | 1-184 | MVNLQWIQESFSWNKNNRNNEHFSAHCSTASIPSSTADYFHALDTLQMQERELAFDAAAIAKASKTEKAAASVLQSIRSEERSRLLQ… |
| M5BXP8 | 10-149 | KQRLEEYINQRTNLIAEERAERFDAQVIASATEKEKRAAEIVSALRAKEAKEIWSASPEKLMYPGMEFLIARETILNTKLFAVVKKL… |
| A0A6V8QTG6 | 41-222 | None |
| A0A2C5XXM7 | 56-227 | None |
| A0A5E3XE97 | 2-165 | None |
| A0A2C9LQV6 | 1-150 | None |
| A0A063BY13 | 15-167 | None |
| A0A166WFN8 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.