DPCstruct | MC33741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7VMY9 | 186-282 | AAHMAVLSATALVYVHGVDGSTWREVWGVARPADAVWGGALGTGVGAWFGAVPIPLDWDRPWQAYPITILTGAYIGYAVGSLISRSS… |
| A0A1B7NLM2 | 2-94 | SLLAGTSLIYVHGTDGAVWQEIWGISRAIDSVWGATVGVGLGAWFGAVPIPLDWDRPWQTYPITIITGAYIGYVLGCMIGRTPLLYG… |
| A0A5N6KQN8 | 691-774 | None |
| A0A0G2ESH0 | 131-241 | None |
| B2B4U2 | 263-343 | None |
| A0A4U0UJF0 | 70-154 | None |
| A0A6J3LZV2 | 1-98 | None |
| A0A1S8B737 | 339-422 | None |
| A0A484E1K8 | 1-97 | None |
| A0A1L9S6N3 | 1101-1184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.