DPCstruct | MC33738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 705 ± 95 aa |
| Standard deviation of domain lengths | 95.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014CLI5 | 1-737 | MKRDQPVFTMDWIEKGQQVDEVLDKLWDYWILAKDSKTFSDDEIIGNIVISAMLYSGLNQKASLEALLEHLKDPAKIRKIEDLNIIF… |
| A0A3E1R6L5 | 5-602 | FDINLPSFERHPLPGDIEYRSTATTFLRAKEFSDWQQSFLKSFSKFPMEKLWCASIMLFEAICTQESFLAIQTNGTVYRSQNVARLE… |
| A0A2N1DAP0 | 9-731 | None |
| A0A7U6R485 | 1-869 | None |
| A0A522LTT3 | 17-793 | None |
| A0A5C7T142 | 8-659 | None |
| A0A1T1ATL3 | 13-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.