DPCstruct | MC33736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y5MUZ0 | 22-148 | EFRTKKGKYFLDLKIICKAVYIGAHHRKEIKSLILKLSRSMNNFRLSTYCGSIPAEKLTENERDIINNALPLVEYLWDGRLRDISSK… |
| V5REB9 | 125-267 | ISQIDFICNVLIPYLDSIEFRTKKYQDYLDFKTIALLILEGKYLTNKGKELIIDLGNSMNNNRLSTNPNPFILDDNTKSELNILIKS… |
| A0A291LJE3 | 123-258 | None |
| A0A291LJD2 | 96-238 | None |
| A0A512UEL5 | 1-159 | None |
| A0A291LIY3 | 115-232 | None |
| A0A291LIZ3 | 194-311 | None |
| A0A2C9DSC3 | 351-497 | None |
| A0A191MWT6 | 569-708 | None |
| A0A889XQ74 | 63-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.