DPCstruct | MC3373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 252 ± 53 aa |
| Standard deviation of domain lengths | 53.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 98.73 |
| Assigned Pfam label(s) | CL0020- CL0368- PF05002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3SQR3 | 1-158 | PDRIYRDFDNHIYHVNGSKGKGPEKIREKYLEIVRLIQDKKPWRLIAFQLGVLSHYIADLNQPLHTATSKSENLFHSKYEKDAEVIE… |
| U4DUH1 | 15-272 | LLTSSASFAFGKYGHQVVCDVAWRAMSAKSQDQVAALLKDTRYPTFAEACVWADEVKSNPEFDRAKPHHYINVKKGAQNVELTQRCD… |
| A0A523D172 | 5-249 | None |
| T0CTW5 | 2-190 | None |
| L0L1F2 | 3-187 | None |
| A0A7J6LH01 | 118-370 | None |
| A0A517NZU8 | 11-241 | None |
| A0A7J2H7D4 | 3-212 | None |
| A0A3D5FW38 | 4-263 | None |
| A0A7T7YEX3 | 99-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.