DPCstruct | MC3372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 140 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837Q799 | 11-161 | KKFDEVSPEEQAVLKTRLADEYRNQSRIKEDGSVVISDTRVKAIESILPYYHGVYGDDPALQTTREHFAMKNNTLPSQEAREKLFDF… |
| A0A2M9F6Y8 | 1-149 | EQGHEHYSDLPAEQQAALKERLKKTMRSNTYDAQTGTITLDDLRVDAMRSNAQYYSELFRDGHEHYAIPHNALNDKAAADDMTAFFW… |
| A0A5E6NLA8 | 11-158 | None |
| A0A368A967 | 60-193 | None |
| A0A1Q9DDP4 | 371-504 | None |
| T1B2G2 | 14-154 | None |
| A0A1I3PKI0 | 110-259 | None |
| A0A0W0WVL5 | 124-291 | None |
| W4U7Y0 | 1-142 | None |
| A0A127NSQ8 | 125-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.