DPCstruct | MC33719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7RAH2 | 36-155 | LKPPKENIARNLDDEIDSSSWDPAKLIMESKNEKIRKLIEQAHDENLPYQIIEGIDGLDSACVKLLLCKASPVIRAAQNLLKNKTES… |
| A0A158NIU1 | 6-106 | LAWDPLKFTLENKNKNVRNLVEQAKNPNLPNQLIARMIGSDSACIRLLLCKSSPIIKAVQTSLNNKLQNYMHRMIAWLPSRKDFEAN… |
| A0A0J9RSE4 | 2-119 | None |
| A0A6P9A8F2 | 131-286 | None |
| A0A182G159 | 120-262 | None |
| A8E6P7 | 41-192 | None |
| A0A067RIT9 | 139-268 | None |
| A0A1J1I9L0 | 10-150 | None |
| E9N024 | 2-114 | None |
| A0A5N4AP36 | 110-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.