DPCstruct | MC33713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 203 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6B1A3 | 203-409 | SDGYSSFLRELRDHFSDVSDFSFAIDAGLDLANVRRSLDQGSKPGLNTVFKVARRFSFSPLDVLMDGGKCLINGELFRRSSTDRSPR… |
| Q13SS4 | 28-215 | INFAQHLGVGKGALSGWMSGDVKPSLPRLVQIAYCCGCAVSDVILGNTVMLRRVPLSSPLGALSPKERDGFKKGKESLLAELDAIVE… |
| A0A7Y0NUP7 | 6-210 | None |
| A0A7I8EI03 | 12-176 | None |
| A0A257C981 | 10-261 | None |
| A0A1N6K0T8 | 266-461 | None |
| A0A2N5GMJ8 | 393-569 | None |
| A0A837UJS1 | 35-276 | None |
| A0A352EZP9 | 2-167 | None |
| A0A4Q4XEB1 | 463-693 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.