DPCstruct | MC33712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 211 ± 25 aa |
| Standard deviation of domain lengths | 24.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T7GRR0 | 2-193 | RQDKARRKIIERQQGRGRRIVSAQSGNQRSVAVGKNVLRSDKWQTFIDFLFSYIKVKLGTEWGKAELAKNLEARHPVMQWYDAVAKA… |
| Q13J98 | 38-258 | RMMRARLEAEEHQRAVQEGLGRPIVVLEMDDRVRIVAVKNRLLHSKKWKTFHDFLGENIKMAIGPGWGNIELKKPLEGRHPLLVWYQ… |
| A0A411HFV4 | 6-265 | None |
| A0A177QB55 | 3-200 | None |
| A0A0G0LP75 | 32-260 | None |
| A0A2L2LMU2 | 50-236 | None |
| A0A1E3XBT9 | 29-234 | None |
| A0A7S8FDM2 | 36-253 | None |
| A0A7G8BDR2 | 100-297 | None |
| Q0C1T5 | 2-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.