DPCstruct | MC33711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0UA20 | 60-151 | TLAMEMEEHSRADHDYKTTVGTVLSVARRSREIFEGAELPEKRQFINFLVQNPQLKERALIFELKRSMNTVLELAHYSASKRKTIGI… |
| A0A1F7Y4N7 | 2-72 | DQDYYFTAEKVLSLASRAAELYESSIADEKRELLSFLLSNCKLEGKKLQFTLKKPFDTIHMHASRQDWLPG |
| A0A1G2QCJ2 | 98-171 | None |
| A0A1J5FQA1 | 7-77 | None |
| A0A1V5SHC1 | 37-138 | None |
| A0A258GDB6 | 120-190 | None |
| A0A1G1KD85 | 4-88 | None |
| A0A2N3AKQ5 | 16-85 | None |
| H8KD22 | 85-156 | None |
| A0A523Y432 | 32-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.