DPCstruct | MC3371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R8N980 | 2-77 | NWADPRLSGRERQVLVAWLLGDSKGAASRELYVSSSTVMTHIARIRDKYAAVGRPAPTKAALLARALQDGLVTLDQ |
| A0A0K0XHH7 | 4-85 | AVKPARPARVELSDREQEILIAWLKSDSKIEVGKALHLAPGTVRTYLQRIRDKYERAGRPARTKAALVARAIQDGYVDVDDL |
| Q0RYK8 | 24-114 | None |
| A0A6G9Z1Q9 | 6-95 | None |
| L7L443 | 54-132 | None |
| A0A2M9BCC2 | 342-432 | None |
| A0A1X7JEU4 | 1-92 | None |
| A0A848L9C8 | 79-168 | None |
| A0A2E1G4F6 | 103-187 | None |
| A0A3S0S1C6 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.