DPCstruct | MC33704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 74.82 |
| Assigned Pfam label(s) | PF07965- PF08725- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7KNB6 | 23-133 | EGVETVIVDVDNDEVPCFGTDEDDCKYNFVYYYNETNCLQVRAQNERECPPQVYMLGIVLGVIAAVVLVGLALLLLWKLLTTIHDRR… |
| A0A4Z2CI26 | 161-312 | CQTKLNCIECLGFNIGPFKGNCSKACSTVVPDTVSQLNKEVKHCELKDSESCWIKFSLEQLDGVDTYKAVIQSERVCPEPPSVTAII… |
| A0A5B7CMK8 | 37-179 | None |
| A0A067REL8 | 20-146 | None |
| A0A4Y2U9D3 | 1-110 | None |
| A0A3P9K9L5 | 381-525 | None |
| A0A0C2JDH3 | 28-197 | None |
| A0A0C2M9X4 | 15-191 | None |
| A0A6I9YEL6 | 186-329 | None |
| A0A482WEE8 | 289-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.