DPCstruct | MC33701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 787 |
|---|---|
| Mean domain length (aa) | 68 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 93.07 |
| Assigned Pfam label(s) | PF11617- CL0213- CL0550- PF01033- PF17690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7K9E2 | 24-89 | RNLEPVDGQWGEWGRYGECSRNCGGGIKRKYRECDNPAPKNGGNYCIGERVKYRSCGTRECPPGSS |
| A0A1S3ILR9 | 95-151 | DGGYSQWSTWGTCSSTCGGGSQTRTRTCTNPTPAFNGNDCSGLGPNSETQQCNTQGC |
| A0A1B0BWZ3 | 10-79 | None |
| I3LWC1 | 74-131 | None |
| A0A834Y1Z8 | 337-397 | None |
| A0A5S6Q9I5 | 241-301 | None |
| A0A6S7GJE3 | 169-231 | None |
| C3ZGX4 | 541-606 | None |
| C3ZMV9 | 27-89 | None |
| K8F396 | 508-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.