DPCstruct | MC3370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4L8V2 | 132-199 | DFVVLSDEVPGVILEIRYYSTYNFVGDRIDGYEEATALITKEAAAALKEVSKDLEKKGYRLKIYDAYR |
| A0A838HJ45 | 29-117 | ATRSATECSVPASTLVDVRSVDATIRTEIRYATPNNFTGRRLPGYETARALLRPEAAAALGRVQARLRAEGLSLKVWDAYRPVRATL… |
| A0A7V7B210 | 288-390 | None |
| A0A2V7KEE5 | 145-231 | None |
| A0A1C3F1D9 | 28-112 | None |
| A0A3D0I1T2 | 281-365 | None |
| A0A656D9U0 | 23-105 | None |
| A0A381QKE3 | 292-400 | None |
| A0A1V5FPE7 | 375-491 | None |
| A0A2K4W3V3 | 13-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.