DPCstruct | MC337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 270 ± 25 aa |
| Standard deviation of domain lengths | 24.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8EPI1 | 2-259 | ELHVVSPQKHRLSHPRDPSSISSSSKGSIKSIYGHRRTDNTCLLRDLSSSNTVDEEDRLPRKSKTWSHDEIMVFYEGLKQCGKDFDG… |
| A0A1S3D1A6 | 1-217 | NTEEKKPPEPEKPLKRRAHELWSTDDKNTFFEALNEYGKDFDAIAKYMMAKVKKKGVVGAEHCSKTRAQVRCFYYRTWHKIAKHLNF… |
| A0A1I8C782 | 2-292 | None |
| A0A6G0HV41 | 192-515 | None |
| V4APH2 | 73-349 | None |
| T1L006 | 1-239 | None |
| A0A4Y7MIG1 | 103-368 | None |
| A0A077ZH21 | 1-260 | None |
| A0A0V1KRI1 | 1-247 | None |
| A0A0N4ZX54 | 2-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.