DPCstruct | MC33698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 156 ± 27 aa |
| Standard deviation of domain lengths | 27.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7K3T2 | 4-119 | DEDAAVLDVGRPDNHVCPVCLRSFTSRIGLGLHKKKQHPVEYNEEINIVRVKPRWSEEEIRILAMDEAQAPPRTMSINIYLWERRDE… |
| A0A077ZM55 | 102-214 | PHTVVCTDCGDQFTTARGLQLHRRNAHIEQFNADRPREKKARWSQFEVLALAKLEVQLPSNIVNINQVLSKLLFEKHGLTRNVEMIK… |
| A0A4Y2U023 | 2-172 | None |
| A0A7M3RJB8 | 144-275 | None |
| A0A1A9XAF0 | 17-141 | None |
| A0A1B0C6M5 | 10-154 | None |
| A0A6A4JTD7 | 42-196 | None |
| A0A4Y2T6V4 | 7-173 | None |
| A0A4Y2L918 | 76-222 | None |
| A0A444T126 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.