DPCstruct | MC3369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 204 ± 25 aa |
| Standard deviation of domain lengths | 25.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9N7L7 | 2-180 | HLIKKQLIELKLTREHNAFRMQHLISEHYRNEMIPVLESVFNDYCNEDEVLILDRLEIDFGVISEKDIEKNRWNDDMLNTFKSSLLD… |
| A0A800K6L0 | 1-211 | MASDDHLIGEAVFDITFDWGEDDVERSLALTDLLRSSVLPLAEAVFDDVAPANSVTVIDRLEVDLGTVPYDDWRRELPERFRSSLRA… |
| A0A539DNN9 | 3-172 | None |
| A0A1S2NEH1 | 1-205 | None |
| D7IVA0 | 3-207 | None |
| A0A090T394 | 16-279 | None |
| A0A840CXK4 | 2-179 | None |
| A0A415M1V2 | 3-202 | None |
| A0A556QW41 | 6-217 | None |
| A0A7X7BDU7 | 14-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.