DPCstruct | MC33674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 183 ± 42 aa |
| Standard deviation of domain lengths | 42.49 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.66 |
| Pfam Score | 87.18 |
| Assigned Pfam label(s) | CL0016- PF01300- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0XSQ8 | 232-411 | PSANPFTRLSPTRAEDVRAVFAEDQVTVVDGGPCRVGIESTIVALDPGAKTARLLRPGMISSEDLAAVLPPDWSWVESSVAGPRAPG… |
| A0A5C1QHP1 | 16-170 | VDYILEGGSCRVGIESTIISLVGTPTILRKGRITKEEIESVIGSVTVNINSSSKPEAPGMLEKHYAPTTKLEIYDNNKEYSGNIAFI… |
| A0A520W9A5 | 413-589 | None |
| A0A7Y7DDQ4 | 1-104 | None |
| A0A2M7W248 | 279-479 | None |
| A0A815VHH3 | 484-672 | None |
| F4PZR8 | 204-496 | None |
| Q2V9C8 | 1-162 | None |
| A0A1Y2H3T5 | 256-465 | None |
| L1LB95 | 137-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.