DPCstruct | MC3367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1HM07 | 89-242 | ARAWSRAGAVVTGLALTAVLGVVGIVAALGAAGAFNLGFGFVLAALLTAGPLSGFLLWLVMRARARGKEIEPALDAAWMAVATDVVQ… |
| A0A800F962 | 65-197 | GLKRRILGTGMVLFASFMVLQGFVEWELGLAAFGSVLGAGGSGMFYWGWQGLQERRNAIMNGLERKILKLAGMRDGRLTVTEVAADM… |
| A0A6J4KYG8 | 136-253 | None |
| A0A660T2B0 | 24-145 | None |
| A0A1R1CFD8 | 1-146 | None |
| A0A2N1A5C7 | 395-539 | None |
| A0A2T1DP12 | 1-148 | None |
| A0A510HGE0 | 32-168 | None |
| A0A511TIP7 | 13-162 | None |
| A0A2G6KEF9 | 13-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.