DPCstruct | MC33669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 215 |
|---|---|
| Mean domain length (aa) | 314 ± 45 aa |
| Standard deviation of domain lengths | 45.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 11.40 |
| Pfam Score | 89.09 |
| Assigned Pfam label(s) | CL0291- PF18862 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1U3U5 | 50-358 | GRILSVSTTNTIYTVVLRSSSAAWFLDSEPPLSLIDYPSTVGPVSLTFRTHYVNEGFASTVPRHLWVEAQGEGPSFKASIDAFWMAA… |
| A0A562N465 | 135-450 | KEYIEIAPNFLIAPNGYDGPIKIGRVTSMRTDDAVASTTALAGNKKVTLVKCGYPNIEFVNGALLIGMPAMVFVVEVPAARQNVAEE… |
| A0A4Y9TID3 | 22-352 | None |
| K9PYU4 | 43-455 | None |
| A0A5E8GXF0 | 3-256 | None |
| A0A7G9Z7J7 | 85-368 | None |
| A0A2P8C6Y0 | 31-403 | None |
| A0A323VDX2 | 49-343 | None |
| A0A6N8W4E5 | 40-433 | None |
| A0A1V2NGU7 | 2-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.