DPCstruct | MC33668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14300 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A506R7F4 | 9-141 | FEFVEPVIEKLEKKGSDSLSELETTILSVWLLEADVNNGGFNQYFWNSSGDFANQVVSSLHNIGAVETAGIVKAALANFPNSTPPTN… |
| A0A3D1U094 | 198-356 | VSIADMAAVSDAELWSILFHALIPRVTGTRDEEYAVVKSWTKGLQMVWATQLVDDEVNNGGFNQYFFNSSGQFAMEAIEGFELIGAH… |
| A0A2W2BQR8 | 44-202 | None |
| A0A1M3IJW0 | 16-167 | None |
| A0A1M5E507 | 10-143 | None |
| A0A344LSN4 | 1-166 | None |
| A0A3E0PV71 | 43-224 | None |
| A0A4R7E305 | 198-365 | None |
| A0A5C6ER13 | 1-152 | None |
| Q67MQ8 | 141-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.