DPCstruct | MC33660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 150 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0041- PF15817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2VNB4 | 1-160 | MGETFHEQLKMDSRFLRTDHRLDTELVDKLILQLNRIYPQILTDKEATKFRDLDVPTCIRLAELLAYLQEKGEEACREFYRALHLHV… |
| A0A5G2R909 | 13-126 | TYCDRLVQDTPFLTGLGRLSEQQVDRIILQLNRYYPQILSNKDAEKFRNPKVSLRVRLCDLLGHLQRSGERDCQEFYRALYIHAQPL… |
| A0A6P9DLX5 | 124-300 | None |
| A0A7J7VPE7 | 1-122 | None |
| A0A803K4P3 | 90-266 | None |
| A0A7N5JIN6 | 1-140 | None |
| A0A662YQW8 | 132-286 | None |
| R0LMQ0 | 19-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.