DPCstruct | MC3366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 123 ± 17 aa |
| Standard deviation of domain lengths | 16.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5IIT1 | 4-117 | SGCSVFMAAKQPEKKDIDLLKEGVTRTQLISEFGAPVISEYKNGKRFEIFKFVQGYSTGTKAGRAFLHGAANVATLGLWELVGTPTE… |
| A0A366WZV0 | 86-212 | VRSVFIALICGAALSGCAANMAATGRDGPDLSVVSQEATRFNVERQLGSPDELQQQANGDWLAVYDVEPRTKPNLARAAGHGTLDLF… |
| A0A2Z3GVF5 | 4-139 | None |
| A0A522WU85 | 4-133 | None |
| A0A1E7I9A5 | 4-136 | None |
| A0A679ICA6 | 2-110 | None |
| A0A2E3MY27 | 2-107 | None |
| A0A1V1WYN9 | 1-168 | None |
| A0A6M3LK21 | 4-102 | None |
| A0A811AHC3 | 62-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.