DPCstruct | MC33659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 379 ± 35 aa |
| Standard deviation of domain lengths | 34.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3KYA4 | 1-340 | MASPLVPSFAASGAGLSVHHAHLFHLAHNWSFTILEQLHVQKLVAVVKEKLSNRQEVSWSNDIKRHLHDVMTLGVGTELLITPDTTL… |
| A0A5N5GLU8 | 12-354 | FWDLNVSSPQTLEGSAKAVPGDPFPLDGARASRALRIQQLFLLGVIPSYNPNSYRYLGSFTHQSLCSDQLPLTDVVKHVLDKSLYSF… |
| A0A7J6VKF1 | 123-528 | None |
| A0A5N5FD99 | 652-1061 | None |
| A0A1D6MPH5 | 15-420 | None |
| A0A6V7PSQ7 | 48-404 | None |
| A0A835JRF9 | 3-402 | None |
| A0A540KF51 | 305-724 | None |
| A0A1R3G5M4 | 295-686 | None |
| A0A6A1V0P3 | 570-982 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.