DPCstruct | MC33658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2KHG0 | 2-114 | LDEVAKAIIEKNGAPISVSNHKEIVSRIKSEAALARTEMLEAMALKETLSNAVRTEPVLLDVDGRVFWKLNGYNGQSDILLQDMGTW… |
| A0A7J0ELJ6 | 160-275 | QDEVAKAIIAKNGEPLSISEHEAIVSEIKTEAAQAHSEMLESKGMVPKGKQRSDAIRTEPIILDVNGHTCWRLRGYSDESKLLLQDV… |
| A0A1R3JIR8 | 520-653 | None |
| A0A1U8AQL1 | 559-674 | None |
| A0A835IKT2 | 828-964 | None |
| A0A7I4CX10 | 200-342 | None |
| A0A6D2HFY8 | 197-317 | None |
| A0A0D3CSX0 | 65-176 | None |
| F6GVR0 | 532-648 | None |
| A0A5N5GDZ1 | 447-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.