DPCstruct | MC33654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 12.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7UFX0 | 1-97 | MARLTIRKDTKLHANPGDDTDGNPFDNTVGLFWFFKSTCPYMQARHDYITAILNVRTGEAVEIALREPLEMLRLCLADNLGVRSQER… |
| A0A1L7UYU3 | 60-180 | KARKAVEKEEQELRDHPGDMFTPPNIFENGVGHFWGIHETRAYMRARYHMVDVLLQVFGTPGGKIDAVQEALDHLVDMLRLCRGDNM… |
| A0A2P5ICS6 | 21-141 | None |
| A0A1B5L9V4 | 58-173 | None |
| A0A161ZLG5 | 2-105 | None |
| A0A3R7ADY6 | 10-131 | None |
| A0A1J7I779 | 32-139 | None |
| A0A6A6C6S1 | 1-97 | None |
| A0A017SRB9 | 2-112 | None |
| A0A397GV05 | 245-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.