DPCstruct | MC33640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 325 |
|---|---|
| Mean domain length (aa) | 249 ± 48 aa |
| Standard deviation of domain lengths | 47.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.75 |
| Pfam Score | 96.55 |
| Assigned Pfam label(s) | PF20899- CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6JNH9 | 24-272 | KVVGLGDLAGELAKSDLVFFGEEHDNLLGHQQRFLLFQQLHARRPDMILSMEMFARDVQEPLNQYLEGKIDEKSFLAKAKPWPQYAQ… |
| A0A640KX32 | 2-248 | KNRIVNYLVSEKGFTNLVLEEGWDRALELDQYVLTGEGNPSQHLSPVFKTKEMLDLLDWIRQYNANPKHKSKVRIIGMDIQSVNENV… |
| A0A2G0XBN7 | 759-1023 | None |
| A0A3Q9D681 | 60-317 | None |
| A0A0B0PFX3 | 20-264 | None |
| A0A7S1XK25 | 35-296 | None |
| A0A7C6P5C0 | 31-251 | None |
| A0A2E9Y2G3 | 55-327 | None |
| A0A7G4RDW1 | 116-344 | None |
| A0A7M5X1A2 | 21-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.