DPCstruct | MC3364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 185 ± 27 aa |
| Standard deviation of domain lengths | 26.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655A8C7 | 2-138 | EYELDAAKLLDFPVMTDMRDPLTTAFHKAKLQADFHKPLRAEDLLDDPDAAGHYLDAVRDYVTAFDTAEAEAMRRRRTGFSREEQQR… |
| A0A7X8RI77 | 34-208 | VLVSLLGISAAVLSITRAPAADEATGPSEFEVAEAHHREVLDEYARWELDPEMLLRYPGLWDRSRPEVHRFFDALAAAGQAPPADYP… |
| A9WNQ1 | 46-207 | None |
| A0A0K2RBL1 | 337-517 | None |
| A0A4Y8X2B7 | 263-458 | None |
| A0A5J5J250 | 112-268 | None |
| A0A1E4NV43 | 31-202 | None |
| A0A132T9Y5 | 8-171 | None |
| A0A0U0ZT69 | 373-584 | None |
| A0A7G8WJP9 | 114-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.