DPCstruct | MC33637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 154 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A403NK79 | 52-228 | DRNPDYEHTLDTLDVEIAMATLPMDFNIYELPGSVYRRAKEIVKKKESPFKEWSAALRATPGILDYSRAAIFALIRSAHPEFYHYSG… |
| A0A826R5P2 | 18-158 | KQTWKTLDDELAYALWPGDVDAGNIDGSIHRWAKNEVIDNDREDWKRISASMRKQPDALRYDRQTIFGLVRERPIDIHKDPVALNKY… |
| F4TGA8 | 244-384 | None |
| A0A2X6RLG2 | 238-380 | None |
| A0A376ZUK7 | 153-288 | None |
| A0A726XV74 | 295-480 | None |
| A0A0K1H0Q4 | 210-354 | None |
| A0A827FIF7 | 50-187 | None |
| A0A3S4I1R2 | 5-191 | None |
| A0A4U9HEJ1 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.