DPCstruct | MC33635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 178 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A826NB17 | 1-172 | DGQNFFDKEHPVYPNVDGTGSAVNTSNIVEQDSFSGLPFYLLDCSRAVKPLIFQERRKPELVARTRIDDDHVFMDNEFLFGASARRA… |
| A0A4D7DDN1 | 114-298 | DELFAALVQSGFTTNCYDGQYFFDTDHPVVGADGVTVSSVSNFQGGAGTAWYLLDLSRAIRPFIYQERIPFALQRRDRDGDDNVFVQ… |
| A0A259DWY8 | 27-191 | None |
| A0A7G2K185 | 1-142 | None |
| A0A3S4UMQ4 | 1-160 | None |
| A0A0D6Q2Q1 | 36-214 | None |
| A0A2Z3HH07 | 397-606 | None |
| A0A377XV11 | 40-230 | None |
| M9MB42 | 108-296 | None |
| A0A2W5A762 | 240-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.