DPCstruct | MC3363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9CVU5 | 1-134 | MKRTLAAVTAALALSAGIIQPLPASAQATGSSAGLSSFLMPQHGDCSPRLFNDALPEWRGSDRTLVVYCDSTFAWVGQYQTDWVEAF… |
| A0A1X7IU04 | 1-118 | MQVTATETVTETPPTTTVTTTETVTDTPVAAPVRADCSADAFRIDFTEPVVMFCDGAWARAGQAQTDHLIVYRAAAGQWRTYEPHGT… |
| A0A7I7Y473 | 9-112 | None |
| A0A097IJN5 | 44-158 | None |
| A0A3R8VVW6 | 43-164 | None |
| A0A3R8VU95 | 281-415 | None |
| A0A7T3Z4G8 | 85-238 | None |
| B1VIH6 | 50-184 | None |
| A0A7X6PM20 | 31-159 | None |
| A0A7X7NL07 | 58-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.