DPCstruct | MC33626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2Z7K9 | 1-122 | MIAYNGRSVDGSPVFKKRILIPQPAQRLLFIDEGLSSPDAYSTRYTTAQWWDQPVTRHGDGTTFSYADGHSDHHKWTGNETIKKGRT… |
| X1SIZ9 | 66-205 | PRVYAFRSYSIAGGMNGVSQDGDWQIYPIIKYSEIKRPASKYVFLEEADPRQWNRGSWVMRPKSKEWVDPFAIWHSRTRSTLGWADG… |
| A0A7C3W720 | 1-89 | None |
| A0A7X8IDM8 | 22-142 | None |
| A0A3D3UMD7 | 1-123 | None |
| A0A660UN84 | 34-151 | None |
| A0A1Z8WLX7 | 31-135 | None |
| A0A7C3TSM5 | 149-253 | None |
| A0A2V5MJI3 | 19-130 | None |
| A0A7C3MFK8 | 43-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.