DPCstruct | MC33624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 144 ± 20 aa |
| Standard deviation of domain lengths | 19.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5RQW0 | 22-164 | NYSASQAALHEFDAVIKKERKRFGSECLDLVFREWFLSELLLGKIQAPGFLDAWNDPAKYDIKQAWLMTEWAGAVKPTVDITKQVNG… |
| A0A1V2N5C6 | 14-160 | ITYEQLTGDLTGVNYSSIRAGLIEFRRRCAMLQHNIMVFQFCRPVWSRWLELATLSGELSTTDNQVFKEVKWIPQGFDWVDPLKDQQ… |
| A0A1A9VKE9 | 542-696 | None |
| A0A857E8M9 | 79-242 | None |
| A0A529ZV52 | 3-121 | None |
| A0A828MSL7 | 1-108 | None |
| A0A645JL73 | 5-122 | None |
| A0A0Q0BVW0 | 80-238 | None |
| A0A7X7FQM4 | 57-229 | None |
| J0ZFW2 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.