DPCstruct | MC33622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 139 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TNJ8 | 303-435 | SDSITLLLPHFERNLRWFTRTQHGNLHPALEAQSSAGLYRWRGRSKHYTLTSGLEDYPRGTTPNEYELHVDLAAWMAFAARTLRRLR… |
| A0A183AIR0 | 236-381 | RQWSLTALPRLHTWYQWFNRTQAGSVPFSYYWKGRDPHEIHQLNPLTLSSGLDDYPRASHPSNTERHLDLRCWMALFARTVARLASL… |
| A0A820ZZJ6 | 226-375 | None |
| A0A418AG34 | 76-225 | None |
| A0A453GCF5 | 157-287 | None |
| A0A5E4R1Q3 | 221-332 | None |
| A0A3P6SH83 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.