DPCstruct | MC3362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4L9Q6 | 4-64 | PADEKIAQLISQTDAQMQRLGWTEVQGREHLQKYYGRRSRLQLTEDELDNFLLFLQLTDTP |
| A0A367RVX1 | 1-64 | MEPVNFSEVIAQTDVEMQRLGWTIYQGREHLIKNYGKRSRTLLTHEKLHEFLQYLVSQPTPTLH |
| A0A3D1PF23 | 153-221 | None |
| A0A845W8Z1 | 175-260 | None |
| A0A166UNK9 | 1-68 | None |
| K9UX53 | 290-351 | None |
| A0A2W4XUB7 | 151-209 | None |
| A0A098TIW9 | 245-312 | None |
| A0A846E5A6 | 6-71 | None |
| A0A563VZV2 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.